Structure of PDB 4v8p Chain GK

Receptor sequence

>4v8pGK (length=148) Species: 5911 (Tetrahymena thermophila)

VSHLKKTRKLRGHVSHGHGRVGKHRKGGCRGGRGKAGGMHHHRILMEKWH
PGYYGKLGMRTFHLKKNPLHCPVVNIDKLWSLVSDATRQKYAEDKKKVPV
IDVTKAGFFKVLGKGRLPNQPVVVKAKYFSKTAERRIVAVGGACVLTA

3D structure

• PDB: 4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
• Chain: GK
• Resolution: 3.52 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GK	V2 S3 H4 L5 K6 K7 T8 R9 K10 R12 G13 V15 S16 H17 G18 H19 G20 R21 V22 K24 H25 R26 K27 G28 G29 C30 R31 G32 G33 R34 G35 K36 A37 G38 H42 H43 R44 I45 K49 W50 Y54 Y55 G56 K57 L58 G59 M60 R61 T62 F63 H64 K66 K67 N68 P69 N76 V84 T88 K91 Y92 K111 L113 G114 R117 N120 S131 K132 T133 R136 R137	V1 S2 H3 L4 K5 K6 T7 R8 K9 R11 G12 V14 S15 H16 G17 H18 G19 R20 V21 K23 H24 R25 K26 G27 G28 C29 R30 G31 G32 R33 G34 K35 A36 G37 H41 H42 R43 I44 K48 W49 Y53 Y54 G55 K56 L57 G58 M59 R60 T61 F62 H63 K65 K66 N67 P68 N75 V83 T87 K90 Y91 K110 L112 G113 R116 N119 S130 K131 T132 R135 R136

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
• PDBsum: 4v8p
• PubMed: 22052974
• UniProt: Q00454|RL27A_TETTH Large ribosomal subunit protein uL15 (Gene Name=RPL27A)