Structure of PDB 4v8p Chain GJ

Receptor sequence
>4v8pGJ (length=138) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]
ARGRGGQVGTKAKVSLGLPVGAVMNCADNSGAKNLYTIACFGIKGHLSKL
PSASIGDMILCSVKKGSPKLRKKVLQAIVIRQRRPWRRRDGVFIYFEDNA
GVIANPKGEMKGSQITGPVAKECADIWPKVASNAGSVV
3D structure
PDB4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
ChainGJ
Resolution3.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna GJ R5 K16 S18 G20 P22 A25 V26 I41 F44 G45 I46 K47 G48 H49 L50 S51 K52 L53 P54 S65 K67 K75 V77 R86 R87 F96 R2 K13 S15 G17 P19 A22 V23 I38 F41 G42 I43 K44 G45 H46 L47 S48 K49 L50 P51 S62 K64 K72 V74 R83 R84 F93
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum4v8p
PubMed22052974
UniProtP0DJ53|RL23_TETTS Large ribosomal subunit protein uL14 (Gene Name=RPL23)

[Back to BioLiP]