Structure of PDB 4v8p Chain GI

Receptor sequence

>4v8pGI (length=198) Species: 5911 (Tetrahymena thermophila)

MFDKLVVIDAKGHLLGRLASYVAKELLSGQRIVVVRTEAINISGSLFRNR
VKFSEFLNKWMNHNPRRGVQHFRAPSRIFWRAVRGMLPHKTPKGAAALER
LKIFEGIPTPYDRVKKQVVVDALKVQRLRNSRPVCKLGDLSASVGWGKQT
LIEKLEEKRRARAKTYHDKKVKQADARKKELAAPALKAIKDKLAQFGY

3D structure

• PDB: 4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
• Chain: GI
• Resolution: 3.52 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GI	F2 D3 K4 K11 L14 G16 R17 S20 Y21 K24 L27 R31 R36 S43 F47 R48 R50 K59 W60 M61 N62 H63 N64 P65 R66 R67 G68 V69 Q70 H71 F72 R73 R81 A82 R84 G85 M86 P88 H89 K90 P92 K93 A96 R100 F104 I107 P108 T109 R113 K115 D121 V125 R127 L128 R129 R132 G145 L155 R159 Y166 H167 K170	F2 D3 K4 K11 L14 G16 R17 S20 Y21 K24 L27 R31 R36 S43 F47 R48 R50 K59 W60 M61 N62 H63 N64 P65 R66 R67 G68 V69 Q70 H71 F72 R73 R81 A82 R84 G85 M86 P88 H89 K90 P92 K93 A96 R100 F104 I107 P108 T109 R113 K115 D121 V125 R127 L128 R129 R132 G145 L155 R159 Y166 H167 K170

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
• PDBsum: 4v8p
• PubMed: 22052974
• UniProt: P0DJ15|RL13A_TETTS Large ribosomal subunit protein uL13 (Gene Name=RPL13A)