Structure of PDB 4v8p Chain GH

Receptor sequence

>4v8pGH (length=201) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]

GRRPARCYRQPKGKPYPKSRYNRGVPDARIRIYDSGRKKATVEEFPYVVH
IVSDEKEQITSEALEAARIAANKNLIKFISKDAFHLRCRVHPWHVLRINK
SGMRGAFGKALGKAARVDIGSILFSVRVKEPHVKYAIDALTRAKAKFPGR
QKVVTSQKWGFTKLTRAQYSRLRNQKKLVTDGSNVKVIGERGPLSRLELF
R

3D structure

PDB

4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.

Chain

Resolution

3.52 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GH	E56 K57 R162 E202 R203 G204 P205 L206 L209	E55 K56 R150 E190 R191 G192 P193 L194 L197
BS02	rna	GH	R3 R4 A6 R7 C8 K13 K15 P16 Y17 Y22 R30 Y34 D35 K39 K40 T61 E63 A64 A67 R88 R90 H92 W94 R98 I99 N100 M115 R116 G117 A118 F119 K158 D193 G194 N196 K198 R213	R2 R3 A5 R6 C7 K12 K14 P15 Y16 Y21 R29 Y33 D34 K38 K39 T60 E62 A63 A66 R87 R89 H91 W93 R97 I98 N99 M103 R104 G105 A106 F107 K146 D181 G182 N184 K186 R201

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	Q235M8\|RL10_TETTS Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]