Structure of PDB 8q3e Chain GGG

Receptor sequence
>8q3eGGG (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ
AVLLPKK
3D structure
PDB8q3e Viral peptide conjugates for metal-warhead delivery to chromatin.
ChainGGG
Resolution2.174 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide GGG E56 Y57 A60 E61 E64 R88 N89 D90 E91 E92 L108 N110 Q112 E44 Y45 A48 E49 E52 R76 N77 D78 E79 E80 L96 N98 Q100
BS02 dna GGG R29 R42 V43 G44 A45 K75 T76 R77 R17 R30 V31 G32 A33 K63 T64 R65
BS03 dna GGG K13 K15 R17 R32 R42 K1 K3 R5 R20 R30
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q3e, PDBe:8q3e, PDBj:8q3e
PDBsum8q3e
PubMed38495982
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]