Structure of PDB 6bok Chain GD

Receptor sequence

>6bokGD (length=255) Species: 562 (Escherichia coli)

LPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMS
ASEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSA
CTVAVMPELPDAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLP
TGIVVECQDERSQHKNKAKALSVLGARIHAAEMAKRQQAEASTRRNLLGS
GDRNRTYNFPQGRVTDHRINLTLYRLDEVMEGKLDMLIEPIIQEHQADQL
AALSE

3D structure

• PDB: 6bok Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: GD
• Resolution: 3.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GD	T119 G120 G121 R133 R183 Q185 Q193 G194 Q314 Y327	T19 G20 G21 R33 R83 Q85 Q93 G94 Q211 Y224
BS02	rna	GD	R116 F227 R228 S229 S230 G231 A232 G233 G234 Q235 H236 V237 N238 T239 T240 D241 S242 R245 E256 R261 Q263 H264 R277 Q287 R294	R16 F127 R128 S129 S130 G131 A132 G133 G134 Q135 H136 V137 N138 T139 T140 D141 S142 R145 E156 R161 Q163 H164 R177 Q187 R194
BS03	rna	GD	G120 G121 E123 Q185 T190 R195 I196 H197 T198	G20 G21 E23 Q85 T90 R95 I96 H97 T98
BS04	rna	GD	E155 G233 G234 Q235 E260 R261	E55 G133 G134 Q135 E160 R161

Gene Ontology

Molecular Function

• GO:0003747 translation release factor activity
• GO:0005515 protein binding
• GO:0016149 translation release factor activity, codon specific
• GO:0043022 ribosome binding

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6bok, PDBe:6bok, PDBj:6bok
• PDBsum: 6bok
• PubMed: 29731232
• UniProt: P0A7I0|RF1_ECOLI Peptide chain release factor RF1 (Gene Name=prfA)