Structure of PDB 8ipa Chain GB

Receptor sequence
>8ipaGB (length=91) Species: 4565 (Triticum aestivum) [Search protein sequence]
TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKA
VGIWGCKDCGKVKAGGAYTMNTASAVTVRSTIRRLREQTEA
3D structure
PDB8ipa Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.
ChainGB
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna GB T2 K3 R4 T5 K6 A8 I10 G12 K13 Y14 G15 T16 R17 Y18 G19 A20 S21 L22 R23 H34 F41 C42 K48 R49 A51 V52 K62 T1 K2 R3 T4 K5 A7 I9 G11 K12 Y13 G14 T15 R16 Y17 G18 A19 S20 L21 R22 H33 F40 C41 K47 R48 A50 V51 K61
BS02 ZN GB C39 C57 C60 C38 C56 C59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ipa, PDBe:8ipa, PDBj:8ipa
PDBsum8ipa
PubMed38267667
UniProtD8L9P6

[Back to BioLiP]