Structure of PDB 7uio Chain GB

Receptor sequence
>7uioGB (length=89) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV
ESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGL
3D structure
PDB7uio Structural basis of a transcription pre-initiation complex on a divergent promoter.
ChainGB
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna GB E8 A10 R15 K18 K20 C21 K23 R46 L49 E1 A3 R8 K11 K13 C14 K16 R39 L42
BS02 dna GB K18 L49 T50 R51 K11 L42 T43 R44
BS03 ZN GB C11 C14 C21 C4 C7 C14
BS04 ZN GB C11 C31 C38 C4 C24 C31
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7uio, PDBe:7uio, PDBj:7uio
PDBsum7uio
PubMed36731470
UniProtP04386|GAL4_YEAST Regulatory protein GAL4 (Gene Name=GAL4)

[Back to BioLiP]