Structure of PDB 7qiz Chain GA

Receptor sequence

>7qizGA (length=184) Species: 4081 (Solanum lycopersicum) [Search protein sequence]

VHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYAL
SRIRNAARMLLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLAL
TVENFLERRLQTLVFKTGMAKSIHHARVLIRQRHIRVGRQVVNVASFMVR
VDSQKHIDFSLTSPFGGGRPGRVKRKNQKSAAKK

3D structure

PDB

7qiz Specific features and methylation sites of a plant ribosome

Chain

Resolution

2.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GA	V2 H3 V4 S5 F6 Y7 R8 N9 Y10 G11 K12 T13 K16 P17 R18 R19 P20 Y21 R39 K41 R42 R46 S52 F73 E74 R80 R81 K122 S123 H126 R128 V129 R132 Q133 R134 H135 Q141 V143 N144 V145 S147 F148 M149 R151 S154 F166 R170 G172 R173 V174 K175 N178	V1 H2 V3 S4 F5 Y6 R7 N8 Y9 G10 K11 T12 K15 P16 R17 R18 P19 Y20 R38 K40 R41 R45 S51 F72 E73 R79 R80 K121 S122 H125 R127 V128 R131 Q132 R133 H134 Q140 V142 N143 V144 S146 F147 M148 R150 S153 F165 R169 G171 R172 V173 K174 N177

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qiz, PDBe:7qiz, PDBj:7qiz
PDBsum	7qiz
PubMed	35643637
UniProt	K4ATQ2

[Back to BioLiP]