Structure of PDB 6b4v Chain GA

Receptor sequence
>6b4vGA (length=37) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.
ChainGA
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna GA M1 K2 R4 A5 S6 V7 K8 I10 K15 R18 R19 H20 R22 Y24 P30 K31 K33 R35 Q36 G37 M1 K2 R4 A5 S6 V7 K8 I10 K15 R18 R19 H20 R22 Y24 P30 K31 K33 R35 Q36 G37
BS02 ZN GA C27 H32 C27 H32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
PDBsum6b4v
PubMed29366636
UniProtQ72I28|RL36_THET2 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]