Structure of PDB 5ibb Chain G8

Receptor sequence
>5ibbG8 (length=103) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CGG
3D structure
PDB5ibb The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
ChainG8
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna G8 K4 H6 K8 K9 S17 G18 K21 V30 P32 K33 Y35 V45 K46 K47 A48 V49 R50 V51 G59 F60 K63 H68 S70 K71 R73 K81 T83 R84 V85 R86 K3 H5 K7 K8 S16 G17 K20 V29 P31 K32 Y34 V44 K45 K46 A47 V48 R49 V50 G58 F59 K62 H67 S69 K70 R72 K80 T82 R83 V84 R85
BS02 ZN G8 C76 R97 C75 R96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5ibb, PDBe:5ibb, PDBj:5ibb
PDBsum5ibb
PubMed27174928
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]