Structure of PDB 4wq1 Chain G8

Receptor sequence
>4wq1G8 (length=104) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVS
PKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKC
GGAL
3D structure
PDB4wq1 Structural insights into the translational infidelity mechanism.
ChainG8
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G8 K4 H6 K8 K9 S17 G18 K19 K21 V30 P32 Y35 V45 K46 K47 A48 V49 R50 V51 G59 F60 H68 S70 K71 R73 K81 T83 R84 V85 R86 K2 H4 K6 K7 S15 G16 K17 K19 V28 P30 Y33 V43 K44 K45 A46 V47 R48 V49 G57 F58 H66 S68 K69 R71 K79 T81 R82 V83 R84
BS02 ZN G8 C79 C99 C77 C97
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wq1, PDBe:4wq1, PDBj:4wq1
PDBsum4wq1
PubMed26037619
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]