Structure of PDB 6kgx Chain G5

Receptor sequence
>6kgxG5 (length=146) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
ADGNKRLDAVNSIVSNASCMVSDAVSGMICENPGLISPGGNCYTNRRMAA
CLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSSIRAV
SIMKAQAVAFITNTATERKMSFAAGDCTSLASEVASYFDRVGAAIS
3D structure
PDB6kgx Structural basis of energy transfer in Porphyridium purpureum phycobilisome.
ChainG5
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB G5 N72 R78 C82 D85 I88 V122 N41 R47 C51 D54 I57 V91
BS02 PEB G5 N35 K36 L38 D39 F153 A154 A155 G156 C158 N4 K5 L7 D8 F122 A123 A124 G125 C127
BS03 PEB G5 C50 M51 D54 G58 C61 A136 Q137 F141 T145 A146 T147 E148 C19 M20 D23 G27 C30 A105 Q106 F110 T114 A115 T116 E117
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030089 phycobilisome

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kgx, PDBe:6kgx, PDBj:6kgx
PDBsum6kgx
PubMed32076272
UniProtP11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]