Structure of PDB 7nz4 Chain G2

Receptor sequence
>7nz4G2 (length=72) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence]
TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFD
TEIPDEEAEKITTVQAAIDYIN
3D structure
PDB7nz4 Cryo-EM structure of MukBEF reveals DNA loop entrapment at chromosomal unloading sites.
ChainG2
Resolution13.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 PNS G2 D35 S36 L37 V40 D34 S35 L36 V39
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Nov 27 00:29:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nz4', asym_id = 'G2', title = 'Cryo-EM structure of MukBEF reveals DNA loop entrapment at chromosomal unloading sites.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nz4', asym_id='G2', title='Cryo-EM structure of MukBEF reveals DNA loop entrapment at chromosomal unloading sites.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006633', uniprot = '', pdbid = '7nz4', asym_id = 'G2'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006633', uniprot='', pdbid='7nz4', asym_id='G2')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>