Structure of PDB 9b3p Chain G

Receptor sequence
>9b3pG (length=102) Species: 10090 (Mus musculus) [Search protein sequence]
VSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVL
ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKS
LI
3D structure
PDB9b3p Structural and Biochemical Characterization of the Nucleosome Containing Variants H3.3 and H2A.Z
ChainG
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G V17 R19 H43 R80 V1 R3 H27 R64
BS02 dna G R31 K37 R45 V46 G47 V78 K79 R80 R15 K21 R29 V30 G31 V62 K63 R64
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006325 chromatin organization
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9b3p, PDBe:9b3p, PDBj:9b3p
PDBsum9b3p
PubMed38920622
UniProtP0C0S6|H2AZ_MOUSE Histone H2A.Z (Gene Name=H2az1)

[Back to BioLiP]