Structure of PDB 8xlp Chain G

Receptor sequence
>8xlpG (length=147) Species: 52970 (Rhodomonas salina) [Search protein sequence]
PQGFTSPKNHFASVIGLWVLFALPVWSAAYKQAGCTTPDWFGVSQVAEDA
PGVGLLAKAAPEYNGPSFREGLEYVFSFVWKPPILIAWKPRVYDEEDQLL
ILSDIVTFEETDLGRRREAIAEASGWYTGNPSFGRSLIEYSEQTRKG
3D structure
PDB8xlp Structure of inactive Photosystem II associated with CAC antenna from Rhodomonas Salina
ChainG
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G F86 T87 H92 S95 F4 T5 H10 S13
BS02 CLA G W162 K163 P164 L167 I168 W80 K81 P82 L85 I86
BS03 CLA G I166 L167 W170 I84 L85 W88
BS04 CLA G Q127 V128 Q45 V46
BS05 CLA G V125 Q127 V43 Q45
BS06 CLA G W100 W108 W18 W26
BS07 CLA G P89 K90 F93 P7 K8 F11
BS08 CLA G F93 W100 A104 W108 F11 W18 A22 W26
External links