Structure of PDB 8wha Chain G

Receptor sequence
>8whaG (length=99) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
RSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELA
GNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLL
3D structure
PDB8wha Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
ChainG
Resolution4.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R18 R33 R1 R16
BS02 dna G R30 R43 R78 R13 R26 R61
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0009294 DNA-mediated transformation
GO:0009611 response to wounding
GO:0009617 response to bacterium
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wha, PDBe:8wha, PDBj:8wha
PDBsum8wha
PubMed38413824
UniProtQ9LD28|H2A6_ARATH Histone H2A.6 (Gene Name=RAT5)

[Back to BioLiP]