Structure of PDB 8wgh Chain G

Receptor sequence
>8wghG (length=98) Species: 141305 (Fittonia albivenis) [Search protein sequence]
ELNPSLVISLSTGVSLFLGRFVFFNFQRENVGKQVPSQNGISHFEAGDER
AKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPNFF
3D structure
PDB8wgh Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI
ChainG
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G Y131 A134 N138 Y84 A87 N91
BS02 CLA G F70 F73 Q74 N77 V78 Q81 F23 F26 Q27 N30 V31 Q34
BS03 CLA G Y131 T135 Y140 F144 Y84 T88 Y93 F97
BS04 CLA G S52 I55 S56 T59 H126 Y130 S5 I8 S9 T12 H79 Y83
BS05 CLA G R67 F68 N108 D109 P110 F113 N114 R20 F21 N61 D62 P63 F66 N67
External links