Structure of PDB 8vy8 Chain G

Receptor sequence
>8vy8G (length=75) Species: 8616 (Bungarus multicinctus) [Search protein sequence]
GIVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCP
SKKPYEEVTCCSTDKCNPHPKQRPG
3D structure
PDB8vy8 Structure of recombinant alpha bungarotoxin complexed with HAP peptide at 2.4 Angstroms resolution.
ChainG
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide G A13 V14 T15 A14 V15 T16
BS02 peptide G T6 A7 T8 S9 I11 D30 R36 G37 K38 V39 V40 H68 K70 T7 A8 T9 S10 I12 D31 R37 G38 K39 V40 V41 H69 K71
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vy8, PDBe:8vy8, PDBj:8vy8
PDBsum8vy8
PubMed38347541
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]