Structure of PDB 8v87 Chain G

Receptor sequence

>8v87G (length=198) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

LSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFN
KYRPETAAEKKERLTKEAAAVAEGASPKPYAVKYGLNHVVALIENKKAKL
VLIANDVDPIELVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAAL
TEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNKAQAKMDK

3D structure

PDB

8v87 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.66 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	G	Y49 P53 E54 Y55 K105 K106 R108 S126 K128 P129 K133 Y134 G135 L136 H138 A141 N145 K147 D158 L162 A184 K193 T194 A196	Y4 P8 E9 Y10 K60 K61 R63 S76 K78 P79 K83 Y84 G85 L86 H88 A91 N95 K97 D108 L112 A134 K143 T144 A146
BS02	rna	G	Y55 V56 Q59 R60 K63 K181 R185	Y10 V11 Q14 R15 K18 K131 R135
BS03	rna	G	N85 E89 A212 K213 S216	N40 E44 A162 K163 S166

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8v87, PDBe:8v87, PDBj:8v87
PDBsum	8v87
PubMed	38632236
UniProt	P17076\|RL8A_YEAST Large ribosomal subunit protein eL8A (Gene Name=RPL8A)

[Back to BioLiP]