Structure of PDB 8urw Chain G |
>8urwG (length=120) Species: 32046 (Synechococcus elongatus) [Search protein sequence] |
EKARWYAVQVASGCEKRVKATLEQRVQTLDAANRILQVEIPETPIVKLKK DGSRQSAEEKVFPGYVLVRMILDDDAWQIVRNTPHVINFVGAEQKRPYGR GRGHVKPMPLSPGEVGRIFK |
|
PDB | 8urw Cryo-EM structure of a cyanobacterial RNAP elongation complex with NusG and CTP. |
Chain | G |
Resolution | 2.79 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
G |
A29 S30 I105 |
A11 S12 I87 |
|
|
|
|