Structure of PDB 8sg5 Chain G

Receptor sequence

>8sg5G (length=449) Species: 9606 (Homo sapiens) [Search protein sequence]

HGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQL
PVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRI
RSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAY
SMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFL
TPVFEALNVSLFPKDTINFLSKSVNRMKKSDFLQLMIDSQKALSDLELAA
QSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTY
DAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIP
TYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFA
LMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRD

3D structure

PDB

8sg5 Differential Effects of Clotrimazole on X-Ray Crystal Structures of Human Cytochrome P450 (CYP) 3A5 and 3A4.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.14.14.1: unspecific monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	G	R105 I118 R130 A305 G306 T309 L373 R375 P433 F434 R439 N440 C441 G443 A447 M451	R76 I89 R101 A258 G259 T262 L326 R328 P386 F387 R392 N393 C394 G396 A400 M404
BS02	CL6	G	R105 F213 F304 A305 T309 V369 L481	R76 F184 F257 A258 T262 V322 L434
BS03	CL6	G	S119 L120 F213 F220 L240 F241	S90 L91 F184 F191 L211 F212
BS04	CL6	G	Y53 R106 F213 G214 L216 D217 I224 T478 G480	Y24 R77 F184 G185 L187 D188 I195 T431 G433

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0005515	protein binding
GO:0008401	retinoic acid 4-hydroxylase activity
GO:0016491	oxidoreductase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0019825	oxygen binding
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0050649	testosterone 6-beta-hydroxylase activity
GO:0070330	aromatase activity
GO:0101020	estrogen 16-alpha-hydroxylase activity

	Biological Process
GO:0002933	lipid hydroxylation
GO:0006805	xenobiotic metabolic process
GO:0008202	steroid metabolic process
GO:0008210	estrogen metabolic process
GO:0009822	alkaloid catabolic process
GO:0042178	xenobiotic catabolic process
GO:0042572	retinol metabolic process
GO:0042573	retinoic acid metabolic process
GO:0046222	aflatoxin metabolic process
GO:0070989	oxidative demethylation

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8sg5, PDBe:8sg5, PDBj:8sg5
PDBsum	8sg5
PubMed	37770228
UniProt	P20815\|CP3A5_HUMAN Cytochrome P450 3A5 (Gene Name=CYP3A5)

[Back to BioLiP]