Structure of PDB 8scb Chain G

Receptor sequence

>8scbG (length=218) Species: 9986 (Oryctolagus cuniculus)

NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPP
AINQFTQVLDRQTATQLLKLAHKYRPETKQEKKQRLLARAERPPVLRAGV
NTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCILKGKARL
GRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGN
VLGPKSVARIAKLEKAKA

3D structure

• PDB: 8scb Structure and consequences of eRF1 glued to the ribosomal decoding center
• Chain: G
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	E33 K34 R35 K37 F39 I41 G42 Q43 D44 I45 Q46 P47 K48 R49 L51 R53 F54 K56 P58 R59 Y60 R62 L70 K72 R73 L74 K75 K110 R113 R132 G139 V140 N141 T142 V161 D162 P163 L166 K187 A188 R196 K197 T198 C199 T200 P244 K245 S246	E5 K6 R7 K9 F11 I13 G14 Q15 D16 I17 Q18 P19 K20 R21 L23 R25 F26 K28 P30 R31 Y32 R34 L42 K44 R45 L46 K47 K82 R85 R92 G99 V100 N101 T102 V121 D122 P123 L126 K147 A148 R156 K157 T158 C159 T160 P204 K205 S206
BS02	rna	G	T52 W57 Y60 I61 Q64 R65 R89 H159 D160 K185 R189	T24 W29 Y32 I33 Q36 R37 R61 H119 D120 K145 R149

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8scb, PDBe:8scb, PDBj:8scb
• PDBsum: 8scb
• PubMed: 38172604
• UniProt: G1STW0|RL7A_RABIT Large ribosomal subunit protein eL8 (Gene Name=RPL7A)