Structure of PDB 8s8h Chain G

Receptor sequence

>8s8hG (length=230) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

MKLNISYPINGTQKCIEIDDEHRVRVFYDKRIGQEVDGESVGDEFKGYVF
KIAGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRNGERKRKSVRGA
IVGPDLAVLALIITKKGEQEIEGITNDTVPKRLGPKRANNIRKFFGLTKE
DDVRDYVIRREVTKGDKSYTKAPKIQRLVTPQRLQRKRQQKSLKIKNAQA
QREAAAEYAQLLAKRLSERKAEKAEVRKRR

3D structure

PDB

8s8h Structural basis of AUC codon discrimination during translation initiation in yeast.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K2 N4 Q13 C15 R31 A53 N56 K58 Q59 G60 F61 Q65 G66 V67 L68 L75 H81 C83 Y84 R85 R87 R88 G90 E91 R92 R94 K95 S96 V108 K131 R132 L133 G134 P135 K136 R137 N139 K143 R154 D155 R159 R160 K164 K167 Y169 K171 A172 P173 K174 R177 L178 V179 R183 L184 Q185 R186 K187 R188 Q190 S192 K194 Q201 R202 L216 R219 K220	K2 N4 Q13 C15 R31 A53 N56 K58 Q59 G60 F61 Q65 G66 V67 L68 L75 H81 C83 Y84 R85 R87 R88 G90 E91 R92 R94 K95 S96 V108 K131 R132 L133 G134 P135 K136 R137 N139 K143 R154 D155 R159 R160 K164 K167 Y169 K171 A172 P173 K174 R177 L178 V179 R183 L184 Q185 R186 K187 R188 Q190 S192 K194 Q201 R202 L216 R219 K220

External links

PDB	RCSB:8s8h, PDBe:8s8h, PDBj:8s8h
PDBsum	8s8h
PubMed	39193907
UniProt	Q6CM04\|RS6_KLULA Small ribosomal subunit protein eS6 (Gene Name=RPS6)

[Back to BioLiP]