Structure of PDB 8s8e Chain G

Receptor sequence

>8s8eG (length=230) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

MKLNISYPINGTQKCIEIDDEHRVRVFYDKRIGQEVDGESVGDEFKGYVF
KIAGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRNGERKRKSVRGA
IVGPDLAVLALIITKKGEQEIEGITNDTVPKRLGPKRANNIRKFFGLTKE
DDVRDYVIRREVTKGDKSYTKAPKIQRLVTPQRLQRKRQQKSLKIKNAQA
QREAAAEYAQLLAKRLSERKAEKAEVRKRR

3D structure

PDB

8s8e Structural basis of AUC codon discrimination during translation initiation in yeast.

Chain

Resolution

3.85 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	K2 N4 S6 Q13 C15 R31 N56 Q59 G60 F61 P62 Q65 G66 L75 H81 C83 Y84 R85 R87 R88 N89 G90 R92 R94 S96 V108 K131 R132 L133 G134 P135 K136 R137 N139 N140 K143 R154 R159 R160 Y169 K171 A172 P173 K174 I175 Q176 R177 V179 R183 L184 Q185 R186 K187 R188 Q189 Q190 K194 I195 A198 Q201 R202 K220 K223	K2 N4 S6 Q13 C15 R31 N56 Q59 G60 F61 P62 Q65 G66 L75 H81 C83 Y84 R85 R87 R88 N89 G90 R92 R94 S96 V108 K131 R132 L133 G134 P135 K136 R137 N139 N140 K143 R154 R159 R160 Y169 K171 A172 P173 K174 I175 Q176 R177 V179 R183 L184 Q185 R186 K187 R188 Q189 Q190 K194 I195 A198 Q201 R202 K220 K223

External links

PDB	RCSB:8s8e, PDBe:8s8e, PDBj:8s8e
PDBsum	8s8e
PubMed	39193907
UniProt	Q6CM04\|RS6_KLULA Small ribosomal subunit protein eS6 (Gene Name=RPS6)

[Back to BioLiP]