Structure of PDB 8s1p Chain G

Receptor sequence
>8s1pG (length=175) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
SRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVL
TVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSG
NKLVLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRA
VRSPEPYKGKGIRYEGEVVRRKEGK
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
ChainG
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G S2 R3 V4 R36 K60 R63 A64 G67 T68 S71 L72 N75 G109 Y110 S111 H112 K139 E140 G143 Y158 K159 K161 K173 K176 S1 R2 V3 R35 K59 R62 A63 G66 T67 S70 L71 N74 G108 Y109 S110 H111 K138 E139 G142 Y157 K158 K160 K172 K175
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP46898|RL6_BACSU Large ribosomal subunit protein uL6 (Gene Name=rplF)

[Back to BioLiP]