Structure of PDB 8rjd Chain G

Receptor sequence

>8rjdG (length=233) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

VVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKV
PPAINQFTQVLDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAKRP
PVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCI
LKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEI
RRHWGGNVLGPKSVARIAKLEKAKAKELATKLG

3D structure

PDB

8rjd UCSF ChimeraX: Meeting modern challenges in visualization and analysis.

Chain

Resolution

2.78574 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	E86 K87 R88 K90 F92 I94 Q96 Q99 R102 L104 R106 F107 V108 K109 P111 R112 Y113 I122 R126 L127 K128 E158 Q161 K163 R166 R185 G192 V193 N194 T195 D215 L219 K240 A241 R249 K250 T251 C252 T253 L295 P297 K298 S299 K305 K312	E7 K8 R9 K11 F13 I15 Q17 Q20 R23 L25 R27 F28 V29 K30 P32 R33 Y34 I43 R47 L48 K49 E79 Q82 K84 R87 R99 G106 V107 N108 T109 D129 L133 K154 A155 R163 K164 T165 C166 T167 L209 P211 K212 S213 K219 K226
BS02	rna	G	T105 W110 Y113 I114 Q117 R118 R142 H212 D213 K238 R242	T26 W31 Y34 I35 Q38 R39 R63 H126 D127 K152 R156

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rjd, PDBe:8rjd, PDBj:8rjd
PDBsum	8rjd
PubMed	38896445
UniProt	G1STW0\|RL7A_RABIT Large ribosomal subunit protein eL8 (Gene Name=RPL7A)

[Back to BioLiP]