Structure of PDB 8qrm Chain G

Receptor sequence

>8qrmG (length=323) Species: 9606 (Homo sapiens)

RHTAFVIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETF
TQEDIDRAIAYLFPSGLFEKRARPVMKHPEQIFPAIQWGEDGRPFHYLFY
TGKQSYYSLMHDVYGMLLNLEKHQVIGSRWLIKEELEEMLVEKLSDLDYM
QFIRLLEKLLTSQCGAAEEEFVQRFRRESKKQLIEPVQYDEQGMAFSKSE
GKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHFVDRL
GKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGLLTTD
PRVRERKKPGQEGARRKFTWKKR

3D structure

• PDB: 8qrm GTPBP8 plays a role in mitoribosome formation in human mitochondria.
• Chain: G
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	R50 H51 F117 E118 L216 Q220 R276 K277 T278 I306 G336 R337 S338 A339 R375 V376 R377 E378 R379 K380 K381 P382 R388 R389 K390 F391 T392 W393 K394 K395 R396	R1 H2 F68 E69 L147 Q151 R203 K204 T205 I233 G263 R264 S265 A266 R302 V303 R304 E305 R306 K307 K308 P309 R315 R316 K317 F318 T319 W320 K321 K322 R323

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qrm, PDBe:8qrm, PDBj:8qrm
• PDBsum: 8qrm
• PubMed: 38969660
• UniProt: P82933|RT09_HUMAN Small ribosomal subunit protein uS9m (Gene Name=MRPS9)