Structure of PDB 8qfd Chain G

Receptor sequence

>8qfdG (length=214) Species: 9606 (Homo sapiens)

NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPP
AINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARRPPVLRAGVNT
VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGR
LVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNVL
GPKSVARIAKLEKA

3D structure

• PDB: 8qfd The UFM1 E3 ligase recognizes and releases 60S ribosomes from ER translocons
• Chain: G
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	E33 K34 R35 K37 F39 I41 Q43 Q46 R49 L51 R53 F54 K56 P58 R59 Y60 K72 R73 L74 E105 K110 K111 R113 R132 G139 V140 N141 T142 D162 L166 K187 R192 R196 K197 T198 C199 T200 P244 K245 S246	E5 K6 R7 K9 F11 I13 Q15 Q18 R21 L23 R25 F26 K28 P30 R31 Y32 K44 R45 L46 E77 K82 K83 R85 R90 G97 V98 N99 T100 D120 L124 K145 R150 R154 K155 T156 C157 T158 P202 K203 S204
BS02	rna	G	T52 Y60 I61 Q64 R65 R89 H159 K185 R189	T24 Y32 I33 Q36 R37 R61 H117 K143 R147

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0045296 cadherin binding

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0045202 synapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qfd, PDBe:8qfd, PDBj:8qfd
• PDBsum: 8qfd
• PubMed: 38383789
• UniProt: P62424|RL7A_HUMAN Large ribosomal subunit protein eL8 (Gene Name=RPL7A)