Structure of PDB 8qf5 Chain G |
>8qf5G (length=120) Species: 30538 (Vicugna pacos) [Search protein sequence] |
GSEVQLQESGGGLVQAGGSLRLSCAASGSIFSGNAMGWYRQAPGKQREVV AVISAGNSSNYVDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVV KRGPQWGMEWGKGTLVTVSS |
|
PDB | 8qf5 Complex between N-lobe of Arc and nanobody E5 |
Chain | G |
Resolution | 1.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
G |
D63 K66 |
D63 K66 |
|
|
|