Structure of PDB 8qbt Chain G

Receptor sequence
>8qbtG (length=171) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
SRVAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEVKLTFGPRD
GYADGWAQAGTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVINLS
LGFSHPVDHQLPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEP
YKGKGVRYADEVVRTKEAKKK
3D structure
PDB8qbt Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity
ChainG
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G S2 R3 N38 A63 Q64 G66 T67 A70 L71 F109 S110 H111 K138 Q139 G142 Q143 P156 Y157 K158 K160 K172 K175 K176 S1 R2 N37 A57 Q58 G60 T61 A64 L65 F103 S104 H105 K132 Q133 G136 Q137 P150 Y151 K152 K154 K166 K169 K170
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qbt, PDBe:8qbt, PDBj:8qbt
PDBsum8qbt
PubMed38503735
UniProtP0AG55|RL6_ECOLI Large ribosomal subunit protein uL6 (Gene Name=rplF)

[Back to BioLiP]