Structure of PDB 8ovj Chain G

Receptor sequence

>8ovjG (length=226) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

HFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPAL
NQFTKVLDRASRNEALKLIKKYAPETRKARRERLQKVAEKAPLAVVTGLQ
EVTRAIEKKQARMVVIANNVDPVELVLWMPNLCRANKIPYAIVKDMARLG
DAIGRKTATCVALTDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQ
LSLRSRAELRKKHARNAGVDAAAIIQ

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	G	R52 T55 R103 R106 G136 L137 Q138 E139 R142 D159 L163 M184 R193 K194 T197	R26 T29 R77 R80 G98 L99 Q100 E101 R104 D121 L125 M146 R155 K156 T159
BS02	rna	G	R49 Q60 R61 R88 K182 D183 R186	R23 Q34 R35 R62 K144 D145 R148
BS03	rna	G	A29 R31 K33 N34 I37 Q39 Y43 R45 L47 R49 F50 R52 K62 R64 V65 R68 R69 R85 A221 S225 R226 L241 S243 R248 K249 H251	A3 R5 K7 N8 I11 Q13 Y17 R19 L21 R23 F24 R26 K36 R38 V39 R42 R43 R59 A183 S187 R188 L203 S205 R210 K211 H213

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	Q4QIP1

[Back to BioLiP]