Structure of PDB 8ouf Chain G

Receptor sequence

>8oufG (length=353) Species: 9606 (Homo sapiens) [Search protein sequence]

KVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFI
NLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRL
VKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKR
QLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQ
MQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKL
LTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEA
ICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLM
IKQ

3D structure

PDB

8ouf 2.7 angstrom cryo-EM structure of human telomerase H/ACA ribonucleoprotein.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

5.4.99.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	G	H68 N99 E104 R111 R141 K302 S304 A305 Y311 G312 A313 K314 M316 P318 G319 D359 H360 G361 R368 V369 R373 R378 K379 W380 G381 L382 G383 P384 K385 A386	H26 N57 E62 R69 R99 K260 S262 A263 Y269 G270 A271 K272 M274 P276 G277 D317 H318 G319 R326 V327 R331 R336 K337 W338 G339 L340 G341 P342 K343 A344

Gene Ontology

	Molecular Function
GO:0003720	telomerase activity
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0009982	pseudouridine synthase activity
GO:0016853	isomerase activity
GO:0034513	box H/ACA snoRNA binding
GO:0070034	telomerase RNA binding

	Biological Process
GO:0000455	enzyme-directed rRNA pseudouridine synthesis
GO:0000495	box H/ACA sno(s)RNA 3'-end processing
GO:0001522	pseudouridine synthesis
GO:0006364	rRNA processing
GO:0006396	RNA processing
GO:0007004	telomere maintenance via telomerase
GO:0009451	RNA modification
GO:0031118	rRNA pseudouridine synthesis
GO:0031120	snRNA pseudouridine synthesis
GO:0032212	positive regulation of telomere maintenance via telomerase
GO:0033979	box H/ACA sno(s)RNA metabolic process
GO:0042254	ribosome biogenesis
GO:0090666	scaRNA localization to Cajal body
GO:0090669	telomerase RNA stabilization
GO:1904867	protein localization to Cajal body
GO:1904872	regulation of telomerase RNA localization to Cajal body
GO:1904874	positive regulation of telomerase RNA localization to Cajal body
GO:1990481	mRNA pseudouridine synthesis

	Cellular Component
GO:0001650	fibrillar center
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005697	telomerase holoenzyme complex
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0015030	Cajal body
GO:0031429	box H/ACA snoRNP complex
GO:0072589	box H/ACA scaRNP complex
GO:0090661	box H/ACA telomerase RNP complex
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ouf, PDBe:8ouf, PDBj:8ouf
PDBsum	8ouf
PubMed	38272871
UniProt	O60832\|DKC1_HUMAN H/ACA ribonucleoprotein complex subunit DKC1 (Gene Name=DKC1)

[Back to BioLiP]