Structure of PDB 8osl Chain G |
>8oslG (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] |
TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILEL AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVL LPK |
|
PDB | 8osl Cooperation between bHLH transcription factors and histones for DNA access. |
Chain | G |
Resolution | 4.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
G |
T16 R17 G28 R29 |
T1 R2 G13 R14 |
|
|
|
|