Structure of PDB 8oos Chain G

Receptor sequence

>8oosG (length=439) Species: 209285 (Thermochaetoides thermophila)

QPKLLNCQLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTVQSISVMAY
LAERYDIWGPFLVVAPASTLHNWQQEVSKFVPDFKVLPYWGTAADRKVLR
KFWDRKHTTYKKDSPFHVMITSYQLVVSDVAYFQKMKWQYMILDEAQAIK
SSQSSRWKCLLGFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSQLK
RLHMILKPFMLRRVKKHVQKELGDKIEIDVFCELSYRQRAMYQSLRNQIS
IMDTLMNLVMQFRKVCNHPDLFERAPSMARFVTDSGKLAKLDELLRELKE
GGHRVLLYFQMTRMIDLMEEYLTYRNYKYCRLDGSTKLEDRRDTVADFQT
RPEIFIFLLSTRAGGLGINLTTADTVIFYDSDWNPTIDSQAMDRAHRLGQ
TKQVTVYRLITRGTIEERIRKRALQKEEVQRVVITGTGS

3D structure

• PDB: 8oos Hexasome-INO80 complex reveals structural basis of noncanonical nucleosome remodeling.
• Chain: G
• Resolution: 3.29 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	G	A1111 K1113 S1117 S1118 R1119 M1258 R1629 W1650 N1651 R1685 R1689 K1693	A148 K150 S154 S155 R156 M256 R362 W383 N384 R418 R422 K426
BS02	dna	G	R1059 R1063 K1064 Q1087 Y1095 M1258 M1262 R1580 G1601 R1608 S1627 A1630	R96 R100 K101 Q124 Y132 M256 M260 R313 G334 R341 S360 A363
BS03	ADP	G	K973 Q976 G1000 G1002 K1003 T1004 V1005 E1039 R1664 L1665	K10 Q13 G37 G39 K40 T41 V42 E76 R397 L398
BS04	ALF	G	M999 K1003 L1633 G1634	M36 K40 L366 G367

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 04:07:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8oos', asym_id = 'G', title = 'Hexasome-INO80 complex reveals structural basis of noncanonical nucleosome remodeling.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8oos', asym_id='G', title='Hexasome-INO80 complex reveals structural basis of noncanonical nucleosome remodeling.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0005524,0005634,0006281,0006338,0006351,0031011,0140658', uniprot = '', pdbid = '8oos', asym_id = 'G'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0005524,0005634,0006281,0006338,0006351,0031011,0140658', uniprot='', pdbid='8oos', asym_id='G')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>