Structure of PDB 8k4e Chain G

Receptor sequence
>8k4eG (length=149) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQR
SGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRW
IVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA
3D structure
PDB8k4e Cryo-EM structure of 30S ribosome with cleaved AP-mRNA bound complex-II
ChainG
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G R3 R4 R9 L29 D32 K34 K35 S36 R77 R78 R91 R101 K113 M115 R1 R2 R7 L27 D30 K32 K33 S34 R75 R76 R89 R99 K111 M113
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k4e, PDBe:8k4e, PDBj:8k4e
PDBsum8k4e
PubMed
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]