Structure of PDB 8j7b Chain G

Receptor sequence
>8j7bG (length=91) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
LSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDR
AKEYVSLLKSNDPIGFNIVDVLAWGSIGHIVAYYILATSSN
3D structure
PDB8j7b Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)
ChainG
Resolution3.22 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G F86 Q87 F25 Q26
BS02 CLA G I66 H140 I5 H79
BS03 CLA G R80 N122 D123 P124 F127 R19 N61 D62 P63 F66
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0009780 photosynthetic NADP+ reduction
GO:0015979 photosynthesis
GO:0042550 photosystem I stabilization
GO:0050821 protein stabilization
Cellular Component
GO:0005634 nucleus
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0009941 chloroplast envelope
GO:0016020 membrane
GO:0030093 chloroplast photosystem I
GO:0031969 chloroplast membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j7b, PDBe:8j7b, PDBj:8j7b
PDBsum8j7b
PubMed37936349
UniProtQ9S7N7|PSAG_ARATH Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]