Structure of PDB 8j6t Chain G

Receptor sequence
>8j6tG (length=76) Species: 9606 (Homo sapiens) [Search protein sequence]
ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTN
LCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB8j6t Structural insights into histone binding and nucleosome assembly by chromatin assembly factor-1.
ChainG
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R116 V117 T118 R58 V59 T60
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j6t, PDBe:8j6t, PDBj:8j6t
PDBsum8j6t
PubMed37616371
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]