Structure of PDB 8ix0 Chain G

Receptor sequence

>8ix0G (length=218) Species: 3562 (Spinacia oleracea) [Search protein sequence]

SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRE
LEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL
GNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDP
LGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL
ADPVNNNAWNFATNFVPG

3D structure

PDB

8ix0 Cryo-EM structures of LHCII in photo-active and photo-protecting states reveal allosteric regulation of light harvesting and excess energy dissipation.

Chain

Resolution

2.64 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CHL	G	Y24 W46	Y11 W33
BS02	CLA	G	G42 Y44 R62 E65 R185	G29 Y31 R49 E52 R172
BS03	CHL	G	V119 H120 Q122 S123	V106 H107 Q109 S110
BS04	CHL	G	R142 L148 P157 F161	R129 L135 P144 F148
BS05	CHL	G	L64 I67 M135 G136 E139	L51 I54 M122 G123 E126
BS06	CLA	G	R70 G158 F161 D162 A167 F173 L176 E180	R57 G145 F148 D149 A154 F160 L163 E167
BS07	CLA	G	V196 Q197 N208 H212 A221	V183 Q184 N195 H199 A208

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ix0, PDBe:8ix0, PDBj:8ix0
PDBsum	8ix0
PubMed	37653340
UniProt	P12333\|CB2A_SPIOL Chlorophyll a-b binding protein, chloroplastic

[Back to BioLiP]