Structure of PDB 8ik3 Chain G

Receptor sequence
>8ik3G (length=326) Species: 9606,208964 [Search protein sequence]
SSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLAS
LQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSI
YFYYSLPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGL
AWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVP
DNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVL
EYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNC
RLIAYQEPADDSSFSLSQEVLRHLRQ
3D structure
PDB8ik3 The mechanism of STING autoinhibition and activation
ChainG
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 1SY G Y163 Y167 R238 T263 Y154 Y158 R229 T254
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0005515 protein binding
GO:0015252 proton channel activity
GO:0019901 protein kinase binding
GO:0031625 ubiquitin protein ligase binding
GO:0035438 cyclic-di-GMP binding
GO:0035591 signaling adaptor activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0061507 2',3'-cyclic GMP-AMP binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0002218 activation of innate immune response
GO:0002221 pattern recognition receptor signaling pathway
GO:0002230 positive regulation of defense response to virus by host
GO:0002753 cytoplasmic pattern recognition receptor signaling pathway
GO:0006914 autophagy
GO:0010468 regulation of gene expression
GO:0016239 positive regulation of macroautophagy
GO:0032092 positive regulation of protein binding
GO:0032481 positive regulation of type I interferon production
GO:0032728 positive regulation of interferon-beta production
GO:0034220 monoatomic ion transmembrane transport
GO:0035458 cellular response to interferon-beta
GO:0045087 innate immune response
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050727 regulation of inflammatory response
GO:0051091 positive regulation of DNA-binding transcription factor activity
GO:0051259 protein complex oligomerization
GO:0051607 defense response to virus
GO:0060340 positive regulation of type I interferon-mediated signaling pathway
GO:0061709 reticulophagy
GO:0070972 protein localization to endoplasmic reticulum
GO:0071360 cellular response to exogenous dsRNA
GO:0071407 cellular response to organic cyclic compound
GO:0140374 antiviral innate immune response
GO:0140896 cGAS/STING signaling pathway
GO:1902600 proton transmembrane transport
Cellular Component
GO:0000139 Golgi membrane
GO:0000421 autophagosome membrane
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005768 endosome
GO:0005776 autophagosome
GO:0005777 peroxisome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0030667 secretory granule membrane
GO:0031410 cytoplasmic vesicle
GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0048471 perinuclear region of cytoplasm
GO:1902554 serine/threonine protein kinase complex
GO:1990231 STING complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ik3, PDBe:8ik3, PDBj:8ik3
PDBsum8ik3
PubMed37086726
UniProtQ86WV6|STING_HUMAN Stimulator of interferon genes protein (Gene Name=STING1);
Q9HYC4

[Back to BioLiP]