Structure of PDB 8htu Chain G

Receptor sequence
>8htuG (length=97) Species: 3218 (Physcomitrium patens) [Search protein sequence]
ANTALTITLSTGALLFLGRFVFLPFQRDNVSRQGLPVQNGVTHFDAGDSR
AQEVTSFLKTNDPAGFTIVDVLAWGALGHAVGFFILATINNGYNPQF
3D structure
PDB8htu Structural insights into the assembly and energy transfer of the Lhcb9-dependent photosystem I from moss Physcomitrium patens.
ChainG
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G F142 A145 N149 F84 A87 N91
BS02 CLA G F80 F83 Q84 N87 V88 Q91 F22 F25 Q26 N29 V30 Q33
BS03 CLA G F83 N87 Q91 F25 N29 Q33
BS04 CLA G T146 N149 Y151 F155 T88 N91 Y93 F97
BS05 CLA G A62 I65 T66 H137 A4 I7 T8 H79
BS06 CLA G R77 K117 T118 N119 D120 P121 F124 I126 V129 R19 K59 T60 N61 D62 P63 F66 I68 V71
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8htu, PDBe:8htu, PDBj:8htu
PDBsum8htu
PubMed37474782
UniProtA0A2K1JC42

[Back to BioLiP]