Structure of PDB 8h9h Chain G

Receptor sequence
>8h9hG (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]
HMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHM
RKHTGEKPYLCQQCGAAFAHNYDLKNHMRVH
3D structure
PDB8h9h ZBTB7A regulates primed-to-naive transition of pluripotent stem cells via recognition of the PNT-associated sequence by zinc fingers 1-2 and recognition of gamma-globin -200 gene element by zinc fingers 1-4.
ChainG
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G A394 K396 D423 K426 Y438 A15 K17 D44 K47 Y59
BS02 dna G K389 Q392 K396 R399 H400 R421 Y451 K10 Q13 K17 R20 H21 R42 Y72
BS03 peptide G Q382 P385 I401 Q3 P6 I22
BS04 ZN G C384 C387 H400 H404 C5 C8 H21 H25
BS05 ZN G C412 C415 H428 H432 C33 C36 H49 H53
BS06 ZN G C440 C443 H456 H460 C61 C64 H77 H81
External links
PDB RCSB:8h9h, PDBe:8h9h, PDBj:8h9h
PDBsum8h9h
PubMed37013936
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]