Structure of PDB 8guk Chain G

Receptor sequence
>8gukG (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVL
PNIQAVLLPKK
3D structure
PDB8guk Structure of the human Bre1 complex bound to the nucleosome
ChainG
Resolution2.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna G R11 A12 K15 T16 R17 R32 R42 R77 R3 A4 K7 T8 R9 R24 R34 R69
BS02 dna G R11 K13 R42 V43 G44 A45 K75 T76 R77 R3 K5 R34 V35 G36 A37 K67 T68 R69
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8guk, PDBe:8guk, PDBj:8guk
PDBsum8guk
PubMed38519511
UniProtP0C0S8|H2A1_HUMAN Histone H2A type 1 (Gene Name=H2AC11)

[Back to BioLiP]