Structure of PDB 8gbt Chain G |
>8gbtG (length=84) Species: 9913 (Bos taurus) [Search protein sequence] |
ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPY HHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK |
|
PDB | 8gbt Detection of a Geminate Photoproduct of Bovine Cytochrome c Oxidase by Time-Resolved Serial Femtosecond Crystallography. |
Chain | G |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
DMU |
G |
G63 F69 |
G63 F69 |
|
|
|
|