Structure of PDB 8fn2 Chain G

Receptor sequence
>8fn2G (length=182) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence]
MNYVPELKKYYKDSVIKELVKEFEYKSIMQVPKLEKIVISVGVGEAVRNK
KLLDSAVLELAQITGQKAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNAMY
EFLYKLIHLALPRVKDFRGINGDAFDGNGNYSFGITEQIIFSEIDYDKIE
RISGLNITIVTTASNDKESKALLLKFGMPFSN
3D structure
PDB8fn2 The structure of a hibernating ribosome in a Lyme disease pathogen.
ChainG
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G G42 G44 A73 K74 F80 A124 F125 D126 N128 N130 S132 F133 G134 T136 G154 L155 N156 T158 G42 G44 A73 K74 F80 A124 F125 D126 N128 N130 S132 F133 G134 T136 G154 L155 N156 T158
BS02 rna G M29 Q30 Q66 K67 V69 K70 T93 R95 M29 Q30 Q66 K67 V69 K70 T93 R95
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fn2, PDBe:8fn2, PDBj:8fn2
PDBsum8fn2
PubMed37907464
UniProtO51443|RL5_BORBU Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]