Structure of PDB 8exy Chain G |
>8exyG (length=110) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
KNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEETDIKNGK KKVVKKKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLL PGEAETILKR |
|
PDB | 8exy Allosteric mechanism of transcription inhibition by NusG-dependent pausing of RNA polymerase. |
Chain | G |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
G |
Y11 D73 W76 T86 |
Y9 D71 W74 T84 |
|
|
|
|