Structure of PDB 8exh Chain G |
>8exhG (length=69) Species: 176299 (Agrobacterium fabrum str. C58) [Search protein sequence] |
GGTDPATMVNNICTFILGPFGQSLAVLGIVAIGISWMFGRASLGLVAGVV GGIVIMFGASFLGKTLTGG |
|
PDB | 8exh Archaeal DNA-import apparatus is homologous to bacterial conjugation machinery |
Chain | G |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
X3D |
G |
L31 F42 |
L27 F38 |
|
|
|