Structure of PDB 8ev3 Chain G

Receptor sequence
>8ev3G (length=164) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
LKVPPAIAQFQKTLDKNTATQVFKLLNKYRPETAAEKKQRLVAEAEAVAN
GKVSKKPYNVKYGLNHVVALIEAKKAKLVLIASDVDPIELVVFLPALCKK
MGVPYAIVKNKARLGTVIHQKTAAVLAVTEVREEDKNELASIVSAVDANF
SAKYDESRRKWGGG
3D structure
PDB8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
ChainG
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G K105 K128 P129 K133 Y134 G135 L136 N137 H138 A141 K147 V157 P159 L162 K183 A184 K193 A196 K37 K56 P57 K61 Y62 G63 L64 N65 H66 A69 K75 V85 P87 L90 K111 A112 K121 A124
BS02 rna G K181 N182 R185 K109 N110 R113
BS03 rna G Q89 K92 Q21 K24
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum8ev3
PubMed36423630
UniProtO13672|RL8_SCHPO Large ribosomal subunit protein eL8 (Gene Name=rpl8)

[Back to BioLiP]