Structure of PDB 8eup Chain G

Receptor sequence
>8eupG (length=163) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
LKVPPAIAQFQKTLDKNTATQVFKLLNKYRPETAAEKKQRLVAEAEAVAN
GKVSKKPYNVKYGLNHVVALIEAKKAKLVLIASDVDPIELVVFLPALCKK
MGVPYAIVKNKARLGTVIHQKTAAVLAVTEVREEDKNELASIVSAVDANF
SAKYDESRRKWGG
3D structure
PDB8eup Chromatin localization of nucleophosmin organizes ribosome biogenesis.
ChainG
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna G E100 K105 K106 R108 K127 K128 P129 Y134 G135 H138 A141 L142 K147 V157 D158 P159 L162 A184 Q192 K193 T194 A196 E32 K37 K38 R40 K55 K56 P57 Y62 G63 H66 A69 L70 K75 V85 D86 P87 L90 A112 Q120 K121 T122 A124
BS02 rna G K181 N182 R185 K109 N110 R113
BS03 rna G Q89 S216 Q21 S144
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eup, PDBe:8eup, PDBj:8eup
PDBsum8eup
PubMed36423630
UniProtO13672|RL8_SCHPO Large ribosomal subunit protein eL8 (Gene Name=rpl8)

[Back to BioLiP]