Structure of PDB 8esr Chain G

Receptor sequence

>8esrG (length=206) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

VKWPEYIRLQRRRKILNLRLKVPPAIAQFQKTLDKNTATQVFKLLNKYRP
ETAAEKKQRLVAEAEAVANGKVSKKPYNVKYGLNHVVALIEAKKAKLVLI
ASDVDPIELVVFLPALCKKMGVPYAIVKNKARLGTVIHQKTAAVLAVTEV
REEDKNELASIVSAVDANFSAKYDESRRKWGGGIMGGKTQALLAKRAKAA
AATVRL

3D structure

PDB

8esr Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	G	P53 E54 Y55 R57 R61 K105 R108 K127 K128 P129 K133 Y134 G135 L136 N137 H138 A141 V157 D158 P159 L162 K183 A184 K193 A196	P4 E5 Y6 R8 R12 K56 R59 K74 K75 P76 K80 Y81 G82 L83 N84 H85 A88 V104 D105 P106 L109 K130 A131 K140 A143
BS02	rna	G	W52 Y55 I56 Q59 R60 K63 K84 D156 K181 N182	W3 Y6 I7 Q10 R11 K14 K35 D103 K128 N129
BS03	rna	G	Q89 K92	Q40 K43

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8esr, PDBe:8esr, PDBj:8esr
PDBsum	8esr
PubMed	36423630
UniProt	O13672\|RL8_SCHPO Large ribosomal subunit protein eL8 (Gene Name=rpl8)

[Back to BioLiP]